PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48759.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 360aa    MW: 40050.5 Da    PI: 8.4266
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48759.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.9e-54171421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelvv+yLkkkv++ +l++ ++i++vd+yk++Pw+Lp+k++ + +ewyfFs+r++ky++g r+nra++sgyWkatg+dk+++s ++++
  KHN48759.1  17 LPPGFRFHPTDEELVVHYLKKKVDSVPLPV-SIIADVDLYKFDPWELPAKASFGAEEWYFFSPRERKYPNGARPNRAATSGYWKATGTDKPICS-GTQK 113
                 79****************************.89***************9888999***************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk+Lvfy g+ pkg+ktdW+mheyr+
  KHN48759.1 114 VGVKKSLVFYGGKPPKGVKTDWIMHEYRV 142
                 ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-668176IPR003441NAC domain
PROSITE profilePS5100560.59317176IPR003441NAC domain
PfamPF023654.3E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MESTEDSSTS SQQQPNLPPG FRFHPTDEEL VVHYLKKKVD SVPLPVSIIA DVDLYKFDPW  60
ELPAKASFGA EEWYFFSPRE RKYPNGARPN RAATSGYWKA TGTDKPICSG TQKVGVKKSL  120
VFYGGKPPKG VKTDWIMHEY RVTENKPNNR PPGCDLGHKK NSLRLDDWVL CRIYKKGNTQ  180
RSHERDDSID DMIGEVPPSI NVGHMSARFH LSRMSTSYSG ALLENDRNTL EGVVIGNGSV  240
NGISNTNNIT SVISSSHQFG TSNSKAELLP FVPSNNTSNS ASKRTLSSLY WNVDDHKHFN  300
LDSNGNVSVL RTDQENNNNN NGTSGSFATL LNQLPQTPSL PQIDGLLRTP YQIQGTNWYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-73111789170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312150.0KT031215.1 Glycine max clone HN_CCL_7 NAC transcription factor (Glyma12g22790.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304513.10.0NAC transcription factor 56-like
SwissprotQ9LD441e-113NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0B2SW810.0A0A0B2SW81_GLYSO; NAC domain-containing protein 18
TrEMBLI1LT130.0I1LT13_SOYBN; Uncharacterized protein
STRINGGLYMA12G22790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-107NAC domain containing protein 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]